TikTok E-commerce Data Analysis Platform
Provides comprehensive data analytics of TikTok eCommerce products, influencers, and creative content that can help create popular content and discover hot sales products.
Get Started

Introduction: This is a tiktok hashtag called facepack.
The music has now attracted more than
4.6K videos and
724.0M views. It is a very
popular content. The following is videos that related to this music.
Top 50 Hot Videos(#facepack)
Besan face pack__Glowing skin Tip #beautytips #simplebeautytips #skincare #glow #faceglow #glowingskin #skincare #beautytips #simplebeautytips #skincare #whiteningfacial #whiteningfacialathome #handwhiteningcream #skinwhiteningtreatment #healthskin #skintreatment #urdubeautytips #hindibeautytips #skinwhitening #antiaging #finelines #wrinklrs #facepack #gorahonekatarika #hairtreatmant #hairloss #fairskin #skinbrightining #darkness #jhuriyan #gorapan #whiteningdrink #skinwhiteningfacepack #coffeefacial #darkspotsfaceremoval #darkneck #darkelbow #howtoremovepigmentation #howtogetwhiteskin #glassskin #homefacial #bridalfacepackathome #darkcircles #pimples #simplebeautytips #pedicureathome #handswhitening #manicureathime #skinwhitening #skintreatment #glowingskin #hindibeautytips #urdubeautytips #beautyroutine #beautysecretbeautytips #simplebeautytips #feetwhitening #whiteninng #menicure #pedicure #trending #viral #natashawaqas #sistrology #whitening #rabipeerzada #menipedi #aroobjatoi #dukybhai #selfcare #skincare #glowingskin #faceglow #mariumpervaiz #nishokhan #bodywhitening #darkbody #skinwhitening #glow #glowingskin #fairnesscream #skinwhiteningcream #cream #nightcream #pigmentation #hyperpigmentation #haldi #aloverauses #besan #glassskinsecret #glowingskinin5days #beauty #beautytips #viral #foryou #foryoupage #fpy #Uk #Usa #germany #france
420.1K
8.1K
82
Skin Beauty Expert🔥🔥
1 years ago
Coffee & Honey Face Mask for Bright Skin⭐️ Video by @ramsha.sultan.khan ➡️ 1 tablespoon finely ground coffee ➡️ 1 tablespoon honey ➡️ Mix well and it’s Ready ! ➡️ Apply for 15 Minutes ➡️ Wash with Water & Apply Moisturiser BENEFITS : Exfoliation: Coffee grounds act as a natural exfoliant, helping to remove dead skin cells and unclog pores. Antioxidant properties: Antioxidants are known to combat signs of aging, reduce inflammation, and promote overall skin health. Moisturization: Honey is a natural humectant, meaning it attracts and retains moisture. When combined with coffee, it can help hydrate and moisturize the skin, leaving it soft and supple. Brightening effect: The caffeine content in coffee can stimulate blood circulation when applied topically. This can help reduce puffiness and give your skin a brighter appearance, reducing the look of dullness and fatigue. Acne-fighting properties: Coffee has antimicrobial properties that may help combat acne-causing bacteria. Additionally, honey has antibacterial and anti-inflammatory properties that can soothe and calm irritated skin, potentially reducing the occurrence of breakouts. To make a coffee and honey face mask, follow these simple steps: Ingredients: ❤️ Video By @ramsha.sultan.khan . . Comment Your Feedback of This Face Mask after trying. 👩💻 . . DISCLAIMER TO FANPAGES ⚠️ Please Tag @ramsha.sultan.khan when you Repost this video. Untagged Reposts will be Reported under Copyright Claim. ‼️ . ⭐️ Video By @ramsha.sultan.khan . . .#diyfacemask #goodskin #skincareroutine #glassskin #facemask #facepack #homemade #diy #skincare #hijab #dryskin #dryskincareroutine #coffee #coffeefacepack #coffeefacemask #islamicpost #allahuakbar #muslimah #instamuslim #muslims #viraltiktok #whatsappstatus #muslimreels #allahlovesyou #islamicreminders #muslimtiktok #reels #ramshasultan #ramshasultankhan
390.1K
14.3K
147
Ramsha Sultan
1 years ago
Saffron can improve your skin tone, smoothen its texture, and brighten your appearance. It can also help reduce excessive sun tan and thus provide a natural radiance.#saffron #saffronfacepack #facepack #facepackforglowingskin #fabuloussaffron #sdsnatural #premafabulous #glowingskin @Sds Collections 2
315.2K
4.7K
16
Sds Collections 1
1 years ago
Green Clay Mask for Oily Skin @ramsha.sultan.khan Agar aapki skin bahut oily hai aur aap open pores se pareshan hain, you can try Green Clay Mask. Kuch time pehle Green Clay Mask Sticks viral hui thi, but aap isko ghar pe hi bahut asani se bana sakte hain. All you need is a Green Clay Mask Mai Alps Goodness ka French Green Clay Mask use kar rahi hu Iss face mask ko banana bahut hi asan hai Aap bas 1-2 spoon Green Clay Mask Powder mai thoda sa pani add kare, aur acche se mix karle That’s it, apka face mask taiyyar hai Iss face mask ko apne face par 15 minute ke liye lagaye, aur pani se dho le. Aapke face ka extra oil kam ho jayega aur apke pores bhi kam nazar ayenge. And you will get a beautiful and radiant skin. Do try it out if you have oily skin. BENEFITS: ⭐️ Absorbs Excess Oil ⭐️ Controls Sebum Production ⭐️ Deep Cleanses Pores ⭐️ Mattifies the Skin ⭐️ Soothes and Calms the Skin ⭐️ Improves Skin Texture ⭐️ Provides Mineral Nourishment ⭐️Can Be Used By Both Men and Women . . . ❤️ Video By @ramsha.sultan.khan . . Comment Your Feedback of This Face Mask after trying. 👩💻 . . DISCLAIMER TO FANPAGES ⚠️ Please Tag @ramsha.sultan.khan when you Repost this video. Untagged Reposts will be Reported under Copyright Claim. ‼️ . . . . . ⭐️ Follow @ramsha.sultan.khan . . . #diyfacemask #goodskin #skincareroutine #glassskin #facemask #facepack #homemade #diy #skincare #hijab #quran #islamicpost #hadiths #dawah #allahuakbar #muslimah #deen #instamuslim #muslims #viraltiktok #oilyskin #muslimreels #allahlovesyou #openpores #faithquotes #muslimtiktok #reels #foryou #ramshasultan #ramshasultankhan
285.7K
9.4K
51
Ramsha Sultan
1 years ago
Multani Mitti Face Wash which brings your favorite age-old skincare remedy for acne & oil control in an easy-to-use daily face wash. Crafted with the goodness of Multani Mitti, the face wash gently cleanses your skin, removes excess oil & prevents acne. What’s great is that the face wash doesn’t dry the skin either. Infused with the goodness of Bulgarian Rose, the face wash hydrates your skin deeply. Enriched with Niacinamide & Vitamin E, it also evens skin tone, controls oil production without leaving your skin dry or stretchy. The result? Clean, clear & hydrated skin minus the oil. Mamaearth Multani Mitti Face Pack heals & prevents acne, hydrates your skin while adding a natural glow to your skin! All this without the hassle of mixing, prepping, or waiting. Just scoop, apply, and unwind. Say hello to oil-free and clearer skin in just 20 minutes! With Bulgarian Rose, the Multani Mitti Face Pack adds a burst of hydration to your skin without leaving it dry or stretchy like other face packs. That’s not all! Aloe Vera & Tea Tree oil in the ingredient list soothe irritation and give a cooling sensation while keeping acne-causing bacteria at bay! So no more acne, no more greasiness, just naturally glowing skin! .#ashacollection7 #facewashproducts #fyppppppppppppppppppppppp #multanimitti #facepack
267.5K
4.0K
65
Asha's Collection
1 years ago
#Hairpack #Organic #Hairloss #HairTreatment #Henna #hennahairmask #Healthyhair #Haircare #tiktokshop #Hairfall #OrganicHenna #Greyhair #hairproblems #hairgrowth #hennahairdye #healthyscalp #scalptreatment #vishabeautycare #LongHair #Herbal #organicproduct #Tiktok #Beauty #TiktokMalaysia #viralvideo #India #fypシ #Testimonies #fyp #facepack #herbalfacepack #organic #organicfacepack #herbal #Skincare #Skinpack #herbalskincare #organicskincare #Pimples #acne #Blackheads #Facial #fairskin
105.1K
5.9K
60
Visha Beauty Care
1 years ago
multani mitti face pack? Well, we’ve got news for you! The age-old skincare duo of Multani Mitti & Rose that's proven to control acne is now available in our latest ready-to-use Multani Mitti Face Pack. Crafted with the goodness of Multani Mitti & Bulgarian Rose, Mamaearth Multani Mitti Face Pack heals & prevents acne, hydrates your skin while adding a natural glow to your skin! All this without the hassle of mixing, prepping, or waiting. Just scoop, apply, and unwind. Say hello to oil-free and clearer skin in just 20 minutes! With Bulgarian Rose, the Multani Mitti Face Pack adds a burst of hydration to your skin without leaving it dry or stretchy like other face packs. That’s not all! Aloe Vera & Tea Tree oil in the ingredient list soothe irritation and give a cooling sensation while keeping acne-causing bacteria at bay! So no more acne, no more greasiness, just naturally glowing skin .. #ashacollection7 #keepsupporting #facewashproducts #multanimettifacewash #facepack
35.0K
440
13
Asha's Collection
1 years ago
Homemade Face Mask for Super Soft and Bright Skin Video By Ramsha Sultan Khan . . #diyfacemask #goodskin #skincareroutine #glassskin #facemask #facepack #homemade #diy #skincare #hijab #quran #islamicpost #hadiths #dawah #allahuakbar #muslimah #deen #instamuslim #muslims #viraltiktok #whatsappstatus #muslimreels #allahlovesyou #islamicreminders #faithquotes #muslimtiktok #reels #foryou #ramshasultan #ramshasultankhan
29.1K
2.5K
27
Ramsha Sultan
2 years ago
#Hairpack #Organic #Hairloss #HairTreatment #Henna #hennahairmask #Healthyhair #Haircare #tiktokshop #Hairfall #OrganicHenna #Greyhair #hairproblems #hairgrowth #hennahairdye #healthyscalp #scalptreatment #vishabeautycare #LongHair #Herbal #organicproduct #Tiktok #Beauty #TiktokMalaysia #viralvideo #India #fypシ #Testimonies #fyp #facepack #herbalfacepack #organic #organicfacepack #herbal #Skincare #Skinpack #herbalskincare #organicskincare #Pimples #acne #Blackheads #Facial #fairskin
26.6K
2.0K
33
Visha Beauty Care
1 years ago
Watch More
Besan face pack__Glowing skin Tip #beautytips #simplebeautytips #skincare #glow #faceglow #glowingskin #skincare #beautytips #simplebeautytips #skincare #whiteningfacial #whiteningfacialathome #handwhiteningcream #skinwhiteningtreatment #healthskin #skintreatment #urdubeautytips #hindibeautytips #skinwhitening #antiaging #finelines #wrinklrs #facepack #gorahonekatarika #hairtreatmant #hairloss #fairskin #skinbrightining #darkness #jhuriyan #gorapan #whiteningdrink #skinwhiteningfacepack #coffeefacial #darkspotsfaceremoval #darkneck #darkelbow #howtoremovepigmentation #howtogetwhiteskin #glassskin #homefacial #bridalfacepackathome #darkcircles #pimples #simplebeautytips #pedicureathome #handswhitening #manicureathime #skinwhitening #skintreatment #glowingskin #hindibeautytips #urdubeautytips #beautyroutine #beautysecretbeautytips #simplebeautytips #feetwhitening #whiteninng #menicure #pedicure #trending #viral #natashawaqas #sistrology #whitening #rabipeerzada #menipedi #aroobjatoi #dukybhai #selfcare #skincare #glowingskin #faceglow #mariumpervaiz #nishokhan #bodywhitening #darkbody #skinwhitening #glow #glowingskin #fairnesscream #skinwhiteningcream #cream #nightcream #pigmentation #hyperpigmentation #haldi #aloverauses #besan #glassskinsecret #glowingskinin5days #beauty #beautytips #viral #foryou #foryoupage #fpy #Uk #Usa #germany #france
420.1K
8.1K
82
Skin Beauty Expert🔥🔥
1 years ago
Coffee & Honey Face Mask for Bright Skin⭐️ Video by @ramsha.sultan.khan ➡️ 1 tablespoon finely ground coffee ➡️ 1 tablespoon honey ➡️ Mix well and it’s Ready ! ➡️ Apply for 15 Minutes ➡️ Wash with Water & Apply Moisturiser BENEFITS : Exfoliation: Coffee grounds act as a natural exfoliant, helping to remove dead skin cells and unclog pores. Antioxidant properties: Antioxidants are known to combat signs of aging, reduce inflammation, and promote overall skin health. Moisturization: Honey is a natural humectant, meaning it attracts and retains moisture. When combined with coffee, it can help hydrate and moisturize the skin, leaving it soft and supple. Brightening effect: The caffeine content in coffee can stimulate blood circulation when applied topically. This can help reduce puffiness and give your skin a brighter appearance, reducing the look of dullness and fatigue. Acne-fighting properties: Coffee has antimicrobial properties that may help combat acne-causing bacteria. Additionally, honey has antibacterial and anti-inflammatory properties that can soothe and calm irritated skin, potentially reducing the occurrence of breakouts. To make a coffee and honey face mask, follow these simple steps: Ingredients: ❤️ Video By @ramsha.sultan.khan . . Comment Your Feedback of This Face Mask after trying. 👩💻 . . DISCLAIMER TO FANPAGES ⚠️ Please Tag @ramsha.sultan.khan when you Repost this video. Untagged Reposts will be Reported under Copyright Claim. ‼️ . ⭐️ Video By @ramsha.sultan.khan . . .#diyfacemask #goodskin #skincareroutine #glassskin #facemask #facepack #homemade #diy #skincare #hijab #dryskin #dryskincareroutine #coffee #coffeefacepack #coffeefacemask #islamicpost #allahuakbar #muslimah #instamuslim #muslims #viraltiktok #whatsappstatus #muslimreels #allahlovesyou #islamicreminders #muslimtiktok #reels #ramshasultan #ramshasultankhan
390.1K
14.3K
147
Ramsha Sultan
1 years ago
Saffron can improve your skin tone, smoothen its texture, and brighten your appearance. It can also help reduce excessive sun tan and thus provide a natural radiance.#saffron #saffronfacepack #facepack #facepackforglowingskin #fabuloussaffron #sdsnatural #premafabulous #glowingskin @Sds Collections 2
315.2K
4.7K
16
Sds Collections 1
1 years ago
Green Clay Mask for Oily Skin @ramsha.sultan.khan Agar aapki skin bahut oily hai aur aap open pores se pareshan hain, you can try Green Clay Mask. Kuch time pehle Green Clay Mask Sticks viral hui thi, but aap isko ghar pe hi bahut asani se bana sakte hain. All you need is a Green Clay Mask Mai Alps Goodness ka French Green Clay Mask use kar rahi hu Iss face mask ko banana bahut hi asan hai Aap bas 1-2 spoon Green Clay Mask Powder mai thoda sa pani add kare, aur acche se mix karle That’s it, apka face mask taiyyar hai Iss face mask ko apne face par 15 minute ke liye lagaye, aur pani se dho le. Aapke face ka extra oil kam ho jayega aur apke pores bhi kam nazar ayenge. And you will get a beautiful and radiant skin. Do try it out if you have oily skin. BENEFITS: ⭐️ Absorbs Excess Oil ⭐️ Controls Sebum Production ⭐️ Deep Cleanses Pores ⭐️ Mattifies the Skin ⭐️ Soothes and Calms the Skin ⭐️ Improves Skin Texture ⭐️ Provides Mineral Nourishment ⭐️Can Be Used By Both Men and Women . . . ❤️ Video By @ramsha.sultan.khan . . Comment Your Feedback of This Face Mask after trying. 👩💻 . . DISCLAIMER TO FANPAGES ⚠️ Please Tag @ramsha.sultan.khan when you Repost this video. Untagged Reposts will be Reported under Copyright Claim. ‼️ . . . . . ⭐️ Follow @ramsha.sultan.khan . . . #diyfacemask #goodskin #skincareroutine #glassskin #facemask #facepack #homemade #diy #skincare #hijab #quran #islamicpost #hadiths #dawah #allahuakbar #muslimah #deen #instamuslim #muslims #viraltiktok #oilyskin #muslimreels #allahlovesyou #openpores #faithquotes #muslimtiktok #reels #foryou #ramshasultan #ramshasultankhan
285.7K
9.4K
51
Ramsha Sultan
1 years ago
Multani Mitti Face Wash which brings your favorite age-old skincare remedy for acne & oil control in an easy-to-use daily face wash. Crafted with the goodness of Multani Mitti, the face wash gently cleanses your skin, removes excess oil & prevents acne. What’s great is that the face wash doesn’t dry the skin either. Infused with the goodness of Bulgarian Rose, the face wash hydrates your skin deeply. Enriched with Niacinamide & Vitamin E, it also evens skin tone, controls oil production without leaving your skin dry or stretchy. The result? Clean, clear & hydrated skin minus the oil. Mamaearth Multani Mitti Face Pack heals & prevents acne, hydrates your skin while adding a natural glow to your skin! All this without the hassle of mixing, prepping, or waiting. Just scoop, apply, and unwind. Say hello to oil-free and clearer skin in just 20 minutes! With Bulgarian Rose, the Multani Mitti Face Pack adds a burst of hydration to your skin without leaving it dry or stretchy like other face packs. That’s not all! Aloe Vera & Tea Tree oil in the ingredient list soothe irritation and give a cooling sensation while keeping acne-causing bacteria at bay! So no more acne, no more greasiness, just naturally glowing skin! .#ashacollection7 #facewashproducts #fyppppppppppppppppppppppp #multanimitti #facepack
267.5K
4.0K
65
Asha's Collection
1 years ago
#Hairpack #Organic #Hairloss #HairTreatment #Henna #hennahairmask #Healthyhair #Haircare #tiktokshop #Hairfall #OrganicHenna #Greyhair #hairproblems #hairgrowth #hennahairdye #healthyscalp #scalptreatment #vishabeautycare #LongHair #Herbal #organicproduct #Tiktok #Beauty #TiktokMalaysia #viralvideo #India #fypシ #Testimonies #fyp #facepack #herbalfacepack #organic #organicfacepack #herbal #Skincare #Skinpack #herbalskincare #organicskincare #Pimples #acne #Blackheads #Facial #fairskin
105.1K
5.9K
60
Visha Beauty Care
1 years ago
multani mitti face pack? Well, we’ve got news for you! The age-old skincare duo of Multani Mitti & Rose that's proven to control acne is now available in our latest ready-to-use Multani Mitti Face Pack. Crafted with the goodness of Multani Mitti & Bulgarian Rose, Mamaearth Multani Mitti Face Pack heals & prevents acne, hydrates your skin while adding a natural glow to your skin! All this without the hassle of mixing, prepping, or waiting. Just scoop, apply, and unwind. Say hello to oil-free and clearer skin in just 20 minutes! With Bulgarian Rose, the Multani Mitti Face Pack adds a burst of hydration to your skin without leaving it dry or stretchy like other face packs. That’s not all! Aloe Vera & Tea Tree oil in the ingredient list soothe irritation and give a cooling sensation while keeping acne-causing bacteria at bay! So no more acne, no more greasiness, just naturally glowing skin .. #ashacollection7 #keepsupporting #facewashproducts #multanimettifacewash #facepack
35.0K
440
13
Asha's Collection
1 years ago
Homemade Face Mask for Super Soft and Bright Skin Video By Ramsha Sultan Khan . . #diyfacemask #goodskin #skincareroutine #glassskin #facemask #facepack #homemade #diy #skincare #hijab #quran #islamicpost #hadiths #dawah #allahuakbar #muslimah #deen #instamuslim #muslims #viraltiktok #whatsappstatus #muslimreels #allahlovesyou #islamicreminders #faithquotes #muslimtiktok #reels #foryou #ramshasultan #ramshasultankhan
29.1K
2.5K
27
Ramsha Sultan
2 years ago
#Hairpack #Organic #Hairloss #HairTreatment #Henna #hennahairmask #Healthyhair #Haircare #tiktokshop #Hairfall #OrganicHenna #Greyhair #hairproblems #hairgrowth #hennahairdye #healthyscalp #scalptreatment #vishabeautycare #LongHair #Herbal #organicproduct #Tiktok #Beauty #TiktokMalaysia #viralvideo #India #fypシ #Testimonies #fyp #facepack #herbalfacepack #organic #organicfacepack #herbal #Skincare #Skinpack #herbalskincare #organicskincare #Pimples #acne #Blackheads #Facial #fairskin
26.6K
2.0K
33
Visha Beauty Care
1 years ago
The instant results of Glory Body Whitening Set & Glory Luxury Skincare Set 🔥🔥 Results speaks 💯💯💯 #trendingnowontiktok #trendingnowontiktok🔥 #trendingnewsmalaysia #trendingnowadays #trendingnowontiktok🔥fyp #fy #fyp #fypシ #fypシ #fypシ゚viral #fyppppppppppppppppppppppp #tiktokshop #tiktokshoppingpaydaysale #tiktokshopping #blackfriday #promo #angpao #whitening #whiteningsoap #whiteninglotion #whiteningscrub #facepack #facemask #serum #rosesoap #bodywhitening #skincare
15.0K
250
0
Glory_Facial_And_Cosmetics
2 years ago
Simple & Easy steps to make facemask for home facial! #fabuloussaffronfacialmask #fabuloussaffronmask #viralbeauty #facemaskviral #viralfacemask #facemask #naturalskincare #fabulousskincare #premafabulous #sdsnatural #facepack #glowing #glowingskin #antipigmentation #brightening #darkspots #antipimples #healthyskin #healthyskincare
14.3K
23
9
Sds Collections 1
9 months ago
#Hairpack #Organic #Hairloss #HairTreatment #Henna #hennahairmask #Healthyhair #Haircare #tiktokshop #Hairfall #OrganicHenna #Greyhair #hairproblems #hairgrowth #hennahairdye #healthyscalp #scalptreatment #vishabeautycare #LongHair #Herbal #organicproduct #Tiktok #Beauty #TiktokMalaysia #viralvideo #India #fypシ #Testimonies #fyp #facepack #herbalfacepack #organic #organicfacepack #herbal #Skincare #Skinpack #herbalskincare #organicskincare #Pimples #acne #Blackheads #Facial #fairskin
12.7K
657
22
Visha Beauty Care
11 months ago
Replying to @അവൾ🌑. My night time routine before going to sleep. Just trying out this serum for 10 days. It hydrates my skin very well. The secret of my clean and healthy skin is our Shea Soap and Enzyme Formula. Click yellow bag to get yours ✨#gee #fyp #enzymeskinformula #loveyourself #skincareupdate #pumpkinmask #skintransformation #founderofgees #exfoliation #healthyskincare #routine #night #facemask #facepack #check #soap #detox #hydration
12.2K
179
0
Gee's Beauty Bar
11 months ago
Natural, Radiant And Mirror Skin with Traditional Ingredients for the face is PURNA FACE MASK!!! ✅KKM ✅HALAL ✅100% ORGANIC and IMMEDIATE RESULTS ✅RESEPI NENEK MOYANG(HOMEMADE) #CapCut #tiktokmalaysia #onemillionaudition #fyp #fyppppppppppppppppppppppp #foryou #shorts #facemask #facemasks #purnafacemask#halopalace#skincare #skin #skincareroutine #skincareyanggampanghilangflekhitam#facemask #skintok #skintific #skincare101 #glowup #glowingskin #glowing #glowskin #facepack #launchingsoon #launchingsoon #viral #trending #fypシ゚viral #fypシ #like #tamil #tamilmuser #tamilsong #tamiltiktok #tamilcomedy #malaysia #malays #malaysiatiktok #melayutiktok #melayu #malay#malaysian#business #smallbusiness #businessowner #smallbusinessowner #businesstiktok #kerjakeras #kerjakerjakerja#kulitminyak #oilyskin #alltypeofskin #glowingskin #CapCut #tiktokmalaysia #onemillionaudition #fyp #fyppppppppppppppppppppppp #foryou #shorts #facemask #facemasks #purnafacemask#halopalace#skincare #skin #skincareroutine #skincareyanggampanghilangflekhitam#facemask #skintok #skintific #skincare101 #glowup #glowingskin #glowing #glowskin #facepack #launchingsoon #launchingsoon #viral #trending #fypシ゚viral #fypシ #like #tamil #tamilmuser #tamilsong #tamiltiktok #tamilcomedy #malaysia #malays #malaysiatiktok #melayutiktok #melayu #malay#malaysian#business #smallbusiness #businessowner #smallbusinessowner #businesstiktok #kerjakeras #kerjakerjakerja#kulitminyak #oilyskin #alltypeofskin #glowingskin#foryoupage #foryou #fyp #duet #viralvideos #trending #comedyvideo #funnyvideos #tiktokchallenge #tiktok #love #memes #likesforlikes🤪 #explorepage #fashion#500kviews #wairal__video #Love #bgm #fypシ゚viral🖤tiktok☆♡🦋myvideo #inshafsmart #tamilstatussongs#maskerviral #maskerwajah #facemaskeroutine #maskerorganik #masker hitam bioglog cosway bioglog cosway#maskerviraltiktok#purnafacemask #halopalace #halopalacestudio#facemaskorganic #facemasktime #facemaskbrush
8.6K
1.0K
3
HaloPalace Studio
1 years ago
Watch More